PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005654-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 1008aa    MW: 110096 Da    PI: 4.9738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005654-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.31.8e-083879346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +WT  E e++ +  + +G++ +k+I++ +  ++t  +c+++++k
    NNU_005654-RA 38 PWTSKEKEIFMEMLATFGKD-FKKISSFLD-HKTTADCIEFYYK 79
                     8*****************99.*********.***********99 PP

2Myb_DNA-binding31.15.4e-10258298345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT eE   +++a +++G + +++I+r++  +R++ qc+ ++ 
    NNU_005654-RA 258 DWTDEEKSVFIQALRLYGRD-FAKISRYVR-TRSRDQCRIFFS 298
                      6*****************77.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.89E-142284IPR009057Homeodomain-like
PROSITE profilePS5129315.6163485IPR017884SANT domain
SMARTSM007176.1E-83583IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-53782IPR009057Homeodomain-like
PfamPF002492.7E-63880IPR001005SANT/Myb domain
PROSITE profilePS5129314.244254305IPR017884SANT domain
SMARTSM007174.2E-9255303IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-5258299IPR009057Homeodomain-like
SuperFamilySSF466892.34E-10258305IPR009057Homeodomain-like
PfamPF002499.3E-9258297IPR001005SANT/Myb domain
CDDcd001679.59E-8259297No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1008 aa     Download sequence    Send to blast
MPALLLDEKE KRLSSLVTSN GLVEDPCAVE KERAMINPWT SKEKEIFMEM LATFGKDFKK  60
ISSFLDHKTT ADCIEFYYKN QKSESFEKIK KKLELRKQEQ SFPSNTYLVT SGKKWNRDGN  120
AASLDLLGAA SVIAATADAN FKTKQNCGGK LFLGGYNDHS LSQGDDCNLE GSSSVDILGN  180
EREAAAADVL VGICGALSSE AMSSCVTSSI DPGEGCQEWK RQKVSSVKDR LLTPEVSQNI  240
DDEETCSDES CGELDSVDWT DEEKSVFIQA LRLYGRDFAK ISRYVRTRSR DQCRIFFSKA  300
RKCLGLDVLY PGTVNEEMPG SDTNGGRSDT EDACLVELES AICSNQSCSK MEVDLASSVT  360
NMNGGVSLQV EPSHLQIDLD RSGEKHGIET QNREASEMKV ETMVPDECRA GAESAKVLDA  420
DNNSIGPEVV NRDDVNVDVV LNSEPNVQLS GSVALADERE IVKEPHTDKV IVPKEEPVSA  480
CEQEEVGQFK SIAAADLHPL PCSDCEDSKV DLDKRQEVSE KVLIDGQDPA NGIDRNSCTG  540
TSCIFTTESS AKREGVNPAY TLPATYPHQI PLELLSSIQK PQVVSWQQKE NVPSVSVGLD  600
SSVHCKDQLK QCRASSSTLD FVVHGDKQQQ KSSSADVFQQ ILLGHESLNR VEHSQILKGY  660
PLQVLNKNAK NTDVDTKSGE ESSKVQSFSK MERKSQHSQY MQELYHEKCN SSRFTHSVAE  720
LPLLPKGQEP SPIDHPRPHS WSSSDTEEQS RRTGDVKLFG QILSHPTPAS KRNSSSPENN  780
ENGASSKLGS SSFNLKSTSN HAVDGVAVSI KLDNSNYSGL EDFPARSHGF WDGSRIQTGL  840
SSQPDSAMLL AKYPAAFGDY SAPSCRVGKQ PVPVVKRNDL NMGCVSVFPT KDLDGIGGLA  900
DYQAYRSYDG TKLQPFTTVD VKGHGIFSEL EKRNGFEVTS FQQQGRSVVG GGILVGGNCP  960
GVSDPVAAIK MHYATSERQR YSGQAQASSS SSTREDESWH GGGDLGRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C7e-16187994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D7e-16187994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253596.10.0PREDICTED: uncharacterized protein LOC104594807 isoform X4
TrEMBLF6HNI10.0F6HNI1_VITVI; Putative uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-90MYB family protein